PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_E46925D04.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family B3
Protein Properties Length: 663aa    MW: 73661.6 Da    PI: 8.6956
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_E46925D04.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.87e-17771561398
                            TT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                     B3  13 sgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                              rl +p +f  ++ +g++++   ++l+ +sg++W v+l      ++ ++ kGWkeFv+++ ++ g f++F++dgrs+f   v +f+
  Traes_4BS_E46925D04.1  77 GERLKIPPSFN-QYlQGQPTG--VVSLKGQSGNKWLVEL--ASDNEGLFFVKGWKEFVRDHSIEMGHFLTFRYDGRSQF--SVVIFD 156
                            5689******8.565888877..7***************..888888******************************99..777776 PP

2B347.92.5e-15557648398
                            EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                     B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                            ++++ s+v     l lp +f++e+   ++ +++l+l +++g+sW+v++ y   ++   l++GW +F  +n+L+  D++vF+l +  + 
  Traes_4BS_E46925D04.1 557 QIMKESYVYVGFFLNLPCEFVRECL--PRAHRKLKLWNPQGKSWDVNYVYYSERCVGGLSGGWGKFSLDNNLEKFDVCVFELFS--KD 640
                            6788899999999***********5..345568***************887777777899*********************875..44 PP

                            ..EEEEE- CS
                     B3  91 elvvkvfr 98 
                            + +v+++r
  Traes_4BS_E46925D04.1 641 NIKVHIYR 648
                            46888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.4E-2066156IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.2E-1467158IPR003340B3 DNA binding domain
SuperFamilySSF1019366.47E-2067156IPR015300DNA-binding pseudobarrel domain
CDDcd100171.53E-1767156No hitNo description
PfamPF023622.0E-1577156IPR003340B3 DNA binding domain
PROSITE profilePS5086313.6278158IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.1E-24546648IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.71E-22548648IPR015300DNA-binding pseudobarrel domain
CDDcd100178.93E-23553648No hitNo description
PROSITE profilePS5086312.52555650IPR003340B3 DNA binding domain
SMARTSM010191.5E-14555650IPR003340B3 DNA binding domain
PfamPF023623.5E-13557648IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MVGNRRRELQ ERDRRRRELL DSARREEHQR ESREAAAAAA MAAADNEKGK GKEQENGGEG  60
GKFGQQFARV FLPQLYGERL KIPPSFNQYL QGQPTGVVSL KGQSGNKWLV ELASDNEGLF  120
FVKGWKEFVR DHSIEMGHFL TFRYDGRSQF SVVIFDGMCI EKPSAFHAKP CKNLVVKIES  180
GKGDMDINAA DPSQVSAAPL EESNGTTRKR VTEMDADGST SKNRSSILEN GMPEASAVTC  240
NVAPTSLNVD MNAADPPEAV VVPLEESNQT TRKRIREINA NDSALQKSLR VREIDANDSA  300
LQKSSRVREI DANDSALQKS SRVREIDAND SALHKSSRVR EIDANDSALH KSSRVGEIDA  360
NDSALHKSSW VREIDANDSA LQKSSMVREI DANDWALQKS SRVREIDAND SSLKKSSGLR  420
EIDANDSSLK KSSGLREIDA NDSALQKSSI ASDKDKKRCP AASVGTYKSA STSLDSTEDS  480
DSSSSMLEQS ISCIKSELTS PIRLGVSKDV ARCGQNSATG KRQLRVLSQR RLVTEIQKDN  540
ALLRAKQFKS KNPFCLQIMK ESYVYVGFFL NLPCEFVREC LPRAHRKLKL WNPQGKSWDV  600
NYVYYSERCV GGLSGGWGKF SLDNNLEKFD VCVFELFSKD NIKVHIYRVV PEITPFLPGP  660
GKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_B3e-1352864922142B3 domain-containing transcription factor VRN
4i1k_A3e-1352864922142B3 domain-containing transcription factor VRN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11217DRRRRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3659260.0AK365926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2039A04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576206.11e-119PREDICTED: B3 domain-containing protein Os11g0197600-like isoform X1
SwissprotQ2R9D21e-76Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLW5EE260.0W5EE26_WHEAT; Uncharacterized protein
STRINGMLOC_62237.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.14e-15B3 family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]